Tube For Ivg Antibody

Monoclonal antibody for SUR1 and SUR2B
SMC-432D	Stressmarq	0.1mg	EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Igg Antibody Laboratories manufactures the tube for ivg antibody reagents distributed by Genprice. The Tube For Ivg Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Tube products are available in stock. Specificity: Tube Category: For Group: Ivg Antibody

True Blue
TargetMol Chemicals	5mg	Ask for price
Description: True Blue

JBS True Blue
MiTeGen	300 µl	EUR 16
Description: JBS True Blue

JBS True Blue
Jena Bioscience GmbH	300µl	EUR 11.84

True Blue Chloride
Toronto Research Chemicals	100mg	EUR 11200
Description: 71431-30-6

True north Cryobox1.5/2mLNatural
Scientific Laboratory Supplies	PK10	EUR 129.6

True Blue Diaceturate Salt
Toronto Research Chemicals	100mg	EUR 15000
Description: 108321-12-6

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Ivg Antibody information

Tubulin Epsilon (TUBe) Antibody
abx128096-1ml	Abbexa	1 ml	EUR 750

Tubulin Epsilon (TUBe) Antibody
abx128096-200l	Abbexa	200 µl	EUR 337.5

Tubulin Epsilon (TUBe) Antibody
abx101415-100l	Abbexa	100 µl	EUR 275

Tubulin Epsilon (TUBe) Antibody
20-abx101415	Abbexa	Ask for price Ask for price Ask for price Ask for price Ask for price	10 ug 50 ug 100 ug 200 ug 1 mg

Tubulin Epsilon (TUBe) Antibody
abx101415-1ml	Abbexa	1 ml	EUR 775

Tubulin Epsilon (TUBe) Antibody
abx101415-200l	Abbexa	200 µl	EUR 350

SS test tube rack for 42 tubes
BAT8160	Scientific Laboratory Supplies	EACH	EUR 110.25

8.0 x 2.4 Tube for EV1500 - EACH
PUM1112	Scientific Laboratory Supplies	EACH	EUR 40.98

Tube Clip for Epp Tubes 5.0ml - EACH
E0030119509	Scientific Laboratory Supplies	EACH	EUR 31.05

Tube Rack Short (for 12 tubes) - EACH
MIX5076	Scientific Laboratory Supplies	EACH	EUR 278.1

tube set for Hi-84532 - EACH
TIT1006	Scientific Laboratory Supplies	EACH	EUR 205.2

Test tube tray for OLS26 - EACH
BAT1066	Scientific Laboratory Supplies	EACH	EUR 321.3

Test tube tray for LSB12 - EACH
BAT1068	Scientific Laboratory Supplies	EACH	EUR 305.1

Test tube tray for LSB18 - EACH
BAT1070	Scientific Laboratory Supplies	EACH	EUR 321.3

Tapered tube, 2ml for S61 pestle
099CS71	Glascol	each	EUR 132

Tapered tube, 2ml for S62 pestle
099CS73	Glascol	each	EUR 123

Tube Rack 143x1.5ml Tubes For BAT1100 - EACH
BAT1112	Scientific Laboratory Supplies	EACH	EUR 261.9