Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D | Stressmarq | 0.1mg | EUR 423.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Igg Antibody Laboratories manufactures the tube for ivg antibody reagents distributed by Genprice. The Tube For Ivg Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Tube products are available in stock. Specificity: Tube Category: For Group: Ivg Antibody
JBS True Blue |
||
Jena Bioscience GmbH | 300µl | EUR 13.7 |
True north Cryobox 0.2mLNatural |
||
Scientific Laboratory Supplies | PK10 | EUR 172.8 |
True north Cryobox 0.5mLNatural |
||
Scientific Laboratory Supplies | PK10 | EUR 153.6 |
True north Cryobox1.5/2mLNatural |
||
Scientific Laboratory Supplies | PK10 | EUR 100.8 |
True north Cryobox 5mLNatural |
||
Scientific Laboratory Supplies | PK10 | EUR 153.6 |
True north Cryobox 5mLBlue |
||
Scientific Laboratory Supplies | PK10 | EUR 153.6 |
True north Cryobox 15mLNatural |
||
Scientific Laboratory Supplies | PK10 | EUR 212.4 |
Test tube tray for LSB18 |
|||
BAT1070 | Scientific Laboratory Supplies | EACH | EUR 285.6 |
Tube Rack 143x1.5ml Tubes For BAT1100 |
|||
BAT1112 | Scientific Laboratory Supplies | EACH | EUR 232.8 |
Tubulin Epsilon (TUBe) Polyclonal Antibody |
|||
CAU22716-100ul | Biomatik Corporation | 100ul | EUR 241.9 |
Tubulin Epsilon (TUBe) Polyclonal Antibody |
|||
CAU22716-200ul | Biomatik Corporation | 200ul | EUR 302.4 |
Tubulin Epsilon (TUBe) Polyclonal Antibody |
|||
CAU22717-100ul | Biomatik Corporation | 100ul | EUR 235.2 |
Tubulin Epsilon (TUBe) Polyclonal Antibody |
|||
CAU22717-200ul | Biomatik Corporation | 200ul | EUR 294 |
FlexiFuge Tube Rotor for 1.5mL Tubes |
|||
ARG1120 | Scientific Laboratory Supplies | EACH | EUR 199.76 |
Flexifuge Tube Rotor for 5mL Tubes |
|||
ARG1124 | Scientific Laboratory Supplies | EACH | EUR 199.76 |
Insert for 50ml Falcon Tube |
|||
CEN0529 | Scientific Laboratory Supplies | EACH | EUR 136.8 |
Tube rack 120X13mm tubes for BAT1100 |
|||
BAT1114 | Scientific Laboratory Supplies | EACH | EUR 232.8 |
Tube rack 70x16mm tubes for BAT1100 |
|||
BAT1116 | Scientific Laboratory Supplies | EACH | EUR 232.8 |
Tube rack 56x15ml tubes for BAT1100 |
|||
BAT1118 | Scientific Laboratory Supplies | EACH | EUR 232.8 |
Tube rack 30x26mm tubes for BAT1100 |
|||
BAT1120 | Scientific Laboratory Supplies | EACH | EUR 234 |
Tube rack 25x50ml tubes for BAT1100 |
|||
BAT1122 | Scientific Laboratory Supplies | EACH | EUR 232.8 |
Techne Tube Rack for OVE3001 |
|||
OVE3036 | Scientific Laboratory Supplies | EACH | EUR 223.2 |
TUBE ROTOR FOR MINI CENTRIFUGE |
|||
6770-RT | CORNING | 1/pk | EUR 80.4 |
Description: Lab Equipment; General Purpose Centrifuges (affliated brand) |
Flexifuge Tube Rotor for (T2075A) |
|||
ARG1130 | Scientific Laboratory Supplies | EACH | EUR 118.81 |