Tube For Ivg Antibody

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Igg Antibody Laboratories manufactures the tube for ivg antibody reagents distributed by Genprice. The Tube For Ivg Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Tube products are available in stock. Specificity: Tube Category: For Group: Ivg Antibody

True Blue

5x5(mg
EUR 2705

JBS True Blue

300µl
EUR 13.7

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

JBS True Blue

300 µl
EUR 16
Description: JBS True Blue

True north Cryobox1.5/2mLNatural

PK10
EUR 129.6

True Blue Diaceturate Salt

100mg
EUR 15000
Description: 108321-12-6

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Ivg Antibody information

Tubulin Epsilon (TUBe) Antibody

abx128096-100l 100 µl
EUR 275

Tubulin Epsilon (TUBe) Antibody

abx128096-1ml 1 ml
EUR 750

Tubulin Epsilon (TUBe) Antibody

abx128096-200l 200 µl
EUR 337.5

Tubulin Epsilon (TUBe) Antibody

abx101415-100l 100 µl
EUR 275

Tubulin Epsilon (TUBe) Antibody

abx101415-1ml 1 ml
EUR 775

Tubulin Epsilon (TUBe) Antibody

abx101415-200l 200 µl
EUR 350

SS test tube rack for 42 tubes

BAT8160 EACH
EUR 110.25

8.0 x 2.4 Tube for EV1500 - EACH

PUM1112 EACH
EUR 40.98

Tube Clip for Epp Tubes 5.0ml - EACH

E0030119509 EACH
EUR 31.05

Tube Rack Short (for 12 tubes) - EACH

MIX5076 EACH
EUR 278.1

tube set for Hi-84532 - EACH

TIT1006 EACH
EUR 205.2

Test tube tray for OLS26 - EACH

BAT1066 EACH
EUR 321.3

Test tube tray for LSB12 - EACH

BAT1068 EACH
EUR 305.1

Test tube tray for LSB18 - EACH

BAT1070 EACH
EUR 321.3

Tapered tube, 2ml for S61 pestle

099CS71 each
EUR 132

Tapered tube, 2ml for S62 pestle

099CS73 each
EUR 123

Tube Rack 143x1.5ml Tubes For BAT1100 - EACH

BAT1112 EACH
EUR 261.9